The short version of c-Met receptor fits in a sentence. The long version — which is the one that helps — is below.
Reviewed 2026-05-03. Anything still debated is marked as such rather than presented as settled.
The full name often given is N-hexanoic-Tyr-Ile-(6)-aminohexanoic amide. This name indicates a chain containing tyrosine, isoleucine, and a six-carbon amino acid derivative. Databases list a CAS Registry Number and a molecular formula for the compound. The peptide is small compared with proteins, and its structure allows it to be studied in cell cultures and animal models. Exact identity depends on the supplier's synthesis and purification process. Minor impurities can remain after synthesis.
Chemically, dihexa belongs to a broader group of angiotensin IV analogs. Researchers have modified the natural peptide to alter stability, binding, or distribution. Such changes can affect how the molecule behaves in experiments. The parent peptide angiotensin IV is involved in various physiological processes, but the modified analog is not identical to it. Public summaries sometimes blur the distinction between the natural fragment and the synthetic research compound. This distinction matters when interpreting study results.
Dihexa is a synthetic peptide that has been examined in laboratory and animal research. Its design is based on angiotensin IV, a naturally occurring peptide fragment produced in the body. The short name dihexa appears in scientific papers and online discussions, while the full chemical name describes a modified peptide chain. It is not a vitamin, mineral, or plant-derived compound. Suppliers typically present it as a research chemical rather than an approved medicine.
Most published work on dihexa consists of preclinical studies using cell cultures or rodents. Reports have described effects on synaptic connectivity and performance on cognitive tasks in some animal models. These findings are generally presented as preliminary and require independent replication. Study designs, doses, and outcome measures vary across experiments, which complicates direct comparison. No large controlled human trials have established efficacy or safety for any medical use. At present, the evidence base is limited.
Regulatory agencies have not approved dihexa as a prescription drug or supplement. In many countries it falls into a gray area when sold for laboratory research. Buyers may encounter products marketed for research use only, which are not intended for human consumption. Purity and identity can vary between suppliers and batches. Certificates of analysis and independent testing are often recommended for research materials. Documentation helps verify what a vial contains.
Discussion of dihexa in online communities sometimes outpaces the scientific record. Anecdotal reports are difficult to verify and may not distinguish effects from placebo or expectation. The absence of approved human data means long-term risks remain unknown. Researchers continue to investigate related compounds and pathways. Open questions include whether animal findings translate to humans and which biological targets matter most. No consensus exists on these points. Current reviews emphasize the need for rigorous clinical research.
| Property | Value | Notes |
|---|---|---|
| Common name | Dihexa | Shorthand used in research literature and supplier catalogs. |
| CAS Registry Number | 1401708-83-5 | Identifier assigned to the synthetic peptide. |
| Molecular formula | C27H44N4O5 | Reported formula; verify with a certificate of analysis. |
| Appearance | White to off-white powder | Typical form for lyophilized research peptides. |
| Typical storage | −20 °C or below, desiccated | Common condition for peptide stability. |
Dihexa is a synthetic compound studied in laboratory and animal models for effects on synaptic connectivity and cognitive performance. It is often described as a peptide analog because its structure incorporates amino acid residues linked to a hexanoic acid group. The molecule is not a naturally occurring human hormone or neurotransmitter. Its name appears in research literature and online discussions, but it has not been approved as a medicine by major regulatory agencies. Most information comes from preclinical experiments rather than controlled human trials.
The compound originated from work on angiotensin IV, a peptide fragment of the renin-angiotensin system. Researchers modified angiotensin IV-related structures to produce molecules with altered stability and activity. Dihexa emerged from that effort and was reported to promote dendritic spine growth in cultured neurons. Some studies link its effects to hepatocyte growth factor signaling and the c-Met receptor, while other work points to insulin-regulated aminopeptidase. The precise primary target remains a subject of investigation, and findings may depend on cell type, assay conditions, and species.
In animal research, dihexa has been administered through several routes, and reports describe improved performance on spatial learning and memory tasks in rodents. These results are frequently cited in discussions of nootropic compounds. However, species differences, small sample sizes, and varied testing protocols limit how far the findings can be generalized. No large randomized controlled trials in humans have established efficacy or long-term safety. Claims about human cognitive enhancement therefore remain speculative, and the compound is best described as an experimental laboratory substance rather than a proven therapeutic or supplement.
Storage recommendations for peptides and peptide-like compounds usually emphasize low temperatures, desiccation, and protection from light. A common practice is to keep dry powder at -20 °C or below and to prepare solutions shortly before use. Repeated freeze-thaw cycles may degrade the material, so aliquoting is often advised. Solubility depends on the solvent; aqueous solubility may be limited, and organic solvents such as dimethyl sulfoxide are sometimes used for stock solutions. Stability data specific to dihexa are sparse, so general peptide handling guidelines are often applied instead.
Analytical confirmation generally combines a separation method with a detection method. Reverse-phase high-performance liquid chromatography can assess purity, while mass spectrometry supports molecular identity. For research-grade material, a certificate of analysis may report a batch-specific purity value, but it does not guarantee biological activity or safety. Regulatory frameworks vary by country; many jurisdictions treat dihexa as a research chemical not intended for human consumption. Purchasers should verify local rules and supplier documentation. The absence of official standards makes independent testing and careful record-keeping important for laboratory work.
Dihexa is a synthetic peptide derived from angiotensin IV, a naturally occurring fragment of the renin-angiotensin system. Researchers modified the angiotensin IV structure to improve metabolic stability and central nervous system activity. It is frequently described as a hepatocyte growth factor mimetic because it can activate the c-Met receptor pathway in experimental systems. Its development reflects interest in small peptides that influence synaptic plasticity and cognitive processes. Most information comes from preclinical studies rather than controlled human trials.
The compound has been examined in animal models for effects on learning, memory, and synaptic connectivity. Some reports describe increased dendritic spine density and improved performance on certain behavioral tasks after administration in rodents. These findings are often cited in discussions of nootropic research peptides, but replication across independent laboratories remains limited. The absence of published phase 1 or phase 2 clinical trial data makes it difficult to assess safety, effective routes, or long-term outcomes in humans. Consequently, claims about cognitive benefits in people remain speculative.
Dihexa is not approved as a medicine in major regulatory jurisdictions. It is commonly sold as a research chemical for laboratory use, though such products may not be standardized or independently verified. Scientific literature on dihexa includes in vitro assays, rodent studies, and reviews that discuss its proposed mechanism. The distinction between peer-reviewed findings and commercial promotion is important when evaluating available information. Open questions include its precise binding interactions, pharmacokinetics, and whether animal results translate to human biology.
Rattlesnakes are venomous snakes that form the genera Crotalus and Sistrurus of the subfamily Crotalinae (the pit vipers). Rattlesnakes are predators that live in a wide array of habitats, hunting small animals such as birds and rodents. Rattlesnakes receive their name from the rattle located at the end of their tails, which makes a loud rattling noise when vibrated that deters predators. Rattlesnakes are the leading contributor to snakebite injuries in North America, but rarely bite unless provoked or threatened; if treated promptly, the bites are seldom fatal. The 36 known species of rattlesnakes have between 65 and 70 subspecies, all native to the Americas, ranging from central Argentina to southern Canada. The largest rattlesnake, the eastern diamondback, can measure up to 2.4 m (7.9 ft) in length. Rattlesnakes are preyed upon by hawks, weasels, kingsnakes, and a variety of other species. Rattlesnakes are heavily preyed upon as neonates, while they are still weak and immature. Large numbers of rattlesnakes are killed by humans. Rattlesnake populations in many areas are severely threatened by habitat destruction, poaching, and extermination campaigns.
Brain levels of endogenous trace amines are several hundred-fold below those for the classical neurotransmitters noradrenaline, dopamine, and serotonin, but their rates of synthesis are equivalent to those of noradrenaline and dopamine and they have a very rapid turnover rate. Endogenous extracellular tissue levels of trace amines measured in the brain are in the low nanomolar range. These low concentrations arise because of their very short half-life. Because of the pharmacological relationship between phenethylamine and amphetamine, the original paper and both reviews suggest that phenethylamine plays a prominent role in mediating the mood-enhancing euphoric effects of a runner's high, as both phenethylamine and amphetamine are potent euphoriants. Skydiving has also been shown to induce a marked increase in urinary phenethylamine concentrations.
In the nonoverlapping triangles APB, BPC, CPD, DPA formed by the diagonals in a convex quadrilateral ABCD, where the diagonals intersect at P, there are the following characterizations of tangential quadrilaterals. Let r1, r2, r3, and r4 denote the radii of the incircles in the four triangles APB, BPC, CPD, and DPA respectively. Chao and Simeonov proved that the quadrilateral is tangential if and only if
Sources: en.wikipedia.org
=== EC 1.99.1 Hydroxylases (now covered by EC 1.14) === EC 1.99.1.1: deleted, Now EC 1.12.7.2, ferredoxin hydrogenase EC 1.99.1.2: deleted, Now EC 1.14.16.1, phenylalanine 4-monooxygenase EC 1.99.1.3: deleted, nicotinate 6-hydroxylase EC 1.99.1.4: deleted, tryptophan 5-hydroxylase EC 1.99.1.5: deleted, Now EC 1.14.13.9, kynurenine 3-monooxygenase EC 1.99.1.6: deleted, steroid 11α-hydroxylase EC 1.99.1.7: deleted, Now EC 1.14.15.4, steroid 11β-monooxygenase EC 1.99.1.8: deleted, steroid 6β-hydroxylase EC 1.99.1.9: deleted, Now EC 1.14.99.9, steroid 17α-monooxygenase EC 1.99.1.10: deleted, steroid 19-hydroxylase EC 1.99.1.11: deleted, Now EC 1.14.99.10, steroid 21-monooxygenase EC 1.99.1.12: deleted, alkoxyaryl hydroxylase EC 1.99.1.13: deleted, covered by EC 1.14.99.7 (squalene monooxygenase) and by EC 5.4.99.7 (lanosterol synthase) EC 1.99.1.14: deleted, Now EC 1.13.11.27, 4-hydroxyphenylpyruvate dioxygenase
In chemistry, yield, also known as reaction yield or chemical yield, refers to the amount of product obtained in a chemical reaction. Yield is one of the primary factors that scientists must consider in organic and inorganic chemical synthesis processes. In chemical reaction engineering, "yield", "conversion" and "selectivity" are terms used to describe ratios of how much of a reactant was consumed (conversion), how much desired product was formed (yield) in relation to the undesired product (selectivity), represented as X, Y, and S. The term yield also plays an important role in analytical chemistry, as individual compounds are recovered in purification processes in a range from quantitative yield (100 %) to low yield (< 50 %).
Cathelicidin antimicrobial peptide (CAMP) is an antimicrobial peptide encoded in the human by the CAMP gene. The active form is LL-37, a 37 amino acid peptide having sequence [LL-37, 37 aa] In humans, CAMP encodes the peptide precursor CAP-18 (18 kDa), which is processed by proteinase 3-mediated extracellular cleavage into the active form LL-37. The cathelicidin family includes 30 types of which LL-37 is the only cathelicidin in the human. Cathelicidins are stored in the secretory granules of neutrophils and macrophages and can be released following activation by leukocytes. Cathelicidin peptides are dual-natured molecules called amphiphiles: one end of the molecule is attracted to water and repelled by fats and proteins, and the other end is attracted to fat and proteins and repelled by water. Members of this family react to pathogens by disintegrating, damaging, or puncturing cell membranes. Cathelicidins thus serve a critical role in mammalian innate immune defense against invasive bacterial infection. The cathelicidin family of peptides are classified as antimicrobial peptides (AMPs). The AMP family also includes the defensins. Whilst the defensins share common structural features, cathelicidin-related peptides are highly heterogeneous. Members of the cathelicidin family of antimicrobial polypeptides are characterized by a highly conserved region (cathelin domain) and a highly variable cathelicidin peptide domain. Cathelicidin peptides have been isolated from many different species of mammals, including marsupials.
Sources: en.wikipedia.org
Dihexa is a synthetic peptide modeled on angiotensin IV. It is used in laboratory and animal research, not as an approved medicine. Human effects remain poorly characterized.
It is produced by chemical synthesis, not extracted from plants or animals. Its design is based on a naturally occurring peptide fragment. Suppliers sell it as a research chemical.
No, dihexa is a modified analog of angiotensin IV. The two share a structural relationship but differ in chemical details. Research on one does not automatically apply to the other.
Published human trials are lacking. Most evidence comes from laboratory and animal studies. Therefore, human benefits and risks are not established.