HGF mimetic comes up often in conversation and rarely with the context attached. Here we lay out the basics in order, then work through the practical considerations.
Last reviewed on 2025-08-06. Where a claim depends on a specific study, the study is described rather than over-claimed.
Dihexa is a synthetic compound studied in laboratory and animal models for effects on synaptic connectivity and cognitive performance. It is often described as a peptide analog because its structure incorporates amino acid residues linked to a hexanoic acid group. The molecule is not a naturally occurring human hormone or neurotransmitter. Its name appears in research literature and online discussions, but it has not been approved as a medicine by major regulatory agencies. Most information comes from preclinical experiments rather than controlled human trials.
The compound originated from work on angiotensin IV, a peptide fragment of the renin-angiotensin system. Researchers modified angiotensin IV-related structures to produce molecules with altered stability and activity. Dihexa emerged from that effort and was reported to promote dendritic spine growth in cultured neurons. Some studies link its effects to hepatocyte growth factor signaling and the c-Met receptor, while other work points to insulin-regulated aminopeptidase. The precise primary target remains a subject of investigation, and findings may depend on cell type, assay conditions, and species.
In animal research, dihexa has been administered through several routes, and reports describe improved performance on spatial learning and memory tasks in rodents. These results are frequently cited in discussions of nootropic compounds. However, species differences, small sample sizes, and varied testing protocols limit how far the findings can be generalized. No large randomized controlled trials in humans have established efficacy or long-term safety. Claims about human cognitive enhancement therefore remain speculative, and the compound is best described as an experimental laboratory substance rather than a proven therapeutic or supplement.
Dihexa is a synthetic peptide that has been examined in laboratory and animal research. Its design is based on angiotensin IV, a naturally occurring peptide fragment produced in the body. The short name dihexa appears in scientific papers and online discussions, while the full chemical name describes a modified peptide chain. It is not a vitamin, mineral, or plant-derived compound. Suppliers typically present it as a research chemical rather than an approved medicine.
The full name often given is N-hexanoic-Tyr-Ile-(6)-aminohexanoic amide. This name indicates a chain containing tyrosine, isoleucine, and a six-carbon amino acid derivative. Databases list a CAS Registry Number and a molecular formula for the compound. The peptide is small compared with proteins, and its structure allows it to be studied in cell cultures and animal models. Exact identity depends on the supplier's synthesis and purification process. Minor impurities can remain after synthesis.
| Property | Value | Notes |
|---|---|---|
| Chemical class | Synthetic peptide analog | Structural features include amino acid residues and a hexanoic acid group. |
| Common synonyms | PNB-0408; N-hexanoic-Tyr-Ile-(6)-aminohexanoic amide | Names vary by source and should be verified. |
| Origin | Angiotensin IV research | Developed as a modified analog in academic laboratories. |
| Primary research focus | Synaptic growth and cognition | Studied mainly in cultured neurons and rodent models. |
| Regulatory status | Not approved as a drug | No accepted human therapeutic or supplement status. |
Dihexa is a synthetic peptide with the chemical name N-hexanoic-Tyr-Ile-(6)-aminohexanoic amide, and it is structurally related to angiotensin IV, a naturally occurring peptide fragment. Researchers developed it as a modified analog intended to alter stability and activity relative to the parent peptide. Its short sequence and fatty acid chain distinguish it from many endogenous peptides, and published studies often describe it under the abbreviation dihexa. The compound is classified as a laboratory compound rather than an approved therapeutic in most jurisdictions.
Early laboratory work focused on its effects on synaptic connectivity and neuronal signaling. In cell and animal models, dihexa has been reported to promote the formation of new synapses, a process called synaptogenesis. These findings have generated interest in cognitive research, but the evidence base remains mostly preclinical. Human clinical trials with clear safety and efficacy endpoints are limited or absent in the public literature. Whether these effects translate to humans is an open question.
Regulatory status differs by country, but dihexa is generally not approved as a therapeutic product. It is often sold as a research chemical, which means purity, labeling, and handling fall outside pharmaceutical drug standards. Some jurisdictions restrict the sale of peptides intended for human consumption. Researchers and suppliers may therefore face different legal requirements depending on location. Import rules and customs enforcement can also affect how such compounds move across borders.
Human safety data are sparse. No widely accepted dosing regimen, long-term safety profile, or clinical efficacy endpoint has been established. Published animal results can suggest directions for further study, but species differences and study design limit direct translation. Open questions include bioavailability, blood-brain barrier penetration, metabolism, and whether observed effects arise from a single target or multiple pathways. Replication across independent laboratories remains an important benchmark for evaluating the strength of preclinical claims.
Reported effects of dihexa are often described in terms of synaptogenesis, a process by which neurons form new synaptic connections. This concept is biologically plausible but difficult to measure directly in living humans. Animal behavioral tests can suggest memory or learning changes, yet such tests have limitations and may not translate to people. The literature includes conflicting or incomplete findings, and some studies are small. As a result, the mechanism remains a subject of investigation rather than a settled explanation.
The proposed mechanism of dihexa involves activation of hepatocyte growth factor and its receptor, c-Met. In cell models, this signaling pathway is associated with dendritic spine formation and synaptic reorganization. Dihexa is described as a stabilized analog of angiotensin IV, which also interacts with related systems. However, the precise binding profile and downstream effects remain incompletely characterized. Most mechanistic evidence comes from in vitro assays and rodent studies rather than human trials.
Laboratory characterization of dihexa typically relies on reverse-phase high-performance liquid chromatography for purity and mass spectrometry for identity. These methods are standard for synthetic peptides and help distinguish the target compound from related impurities or degradation products. Because dihexa is a small peptide-like molecule, it may be susceptible to hydrolysis under certain conditions. Storage recommendations generally emphasize low temperature, dryness, and protection from light. Analytical certificates from suppliers vary in detail, so independent verification can be important for research use.
The difference itself is quite small, but when looking at an entire chain of RNA the slight difference amounts to a sizable impact. Like most sugars, ribose exists as a mixture of cyclic forms in equilibrium with its linear form, and these readily interconvert especially in aqueous solution. The name "ribose" is used in biochemistry and biology to refer to all of these forms, though more specific names for each are used when required. In its linear form, ribose can be recognised as the pentose sugar with all of its hydroxyl functional groups on the same side in its Fischer projection. d-Ribose has these hydroxyl groups on the right hand side and is associated with the systematic name (2R,3R,4R)-2,3,4,5-tetrahydroxypentanal, whilst l-ribose has its hydroxyl groups appear on the left hand side in a Fischer projection.
ALFA-tag, a de novo designed helical peptide tag (SRLEEELRRRLTE) for biochemical and microscopy applications. The tag is recognized by a repertoire of single-domain antibodies AviTag, a peptide allowing biotinylation by the enzyme BirA and so the protein can be isolated by streptavidin (GLNDIFEAQKIEWHE) EPEA-tag, commercially called CaptureSelect C-tag, a 4 AA peptide that is recognized by a VHH or single-domain camelid antibody which was discovered through phage display (EPEA) Calmodulin-tag, a peptide bound by the protein calmodulin (KRRWKKNFIAVSAANRFKKISSSGAL) iCapTag™ (intein Capture Tag), a self-removing peptide-based tag (MIKIATRKYLGKQNVYGIGVERDHNFALKNGFIAHN). The iCapTag™ is controlled by pH change. Typically the pH change occurs from pH 8.5 to pH 6.2 and causes release of tagless target-protein to eluent. If needed the pH shift and buffers can be optimized for protein-specific purification method (e.g., for membrane proteins detergent could be added to the buffers to increase solubility of the protein). In contrast to other protein purification methods, this method is not relaying on proteases to cleave off a tag from tag-protein complex. Instead, during elution phase since buffer pH is changed from 8.5 to pH 6.2 that triggers cleavage reaction resulting in a release of tagless target protein while highly engineered tag stays attached to the column. The expected purity of tagless target proteins or peptides is between 95-99%. The iCapTag™ contains patented component derived from Nostoc punctiforme (Npu) intein.
Dubnium is a synthetic chemical element; it has symbol Db and atomic number 105. It is highly radioactive: the most stable known isotope, dubnium-268, has a half-life of about 16 hours. This greatly limits extended research on the element. Dubnium does not occur naturally on Earth and is produced artificially. The Soviet Joint Institute for Nuclear Research (JINR) claimed the first discovery of the element in 1968, followed by the American Lawrence Berkeley Laboratory in 1970. Both teams proposed their names for the new element and used them without formal approval. The long-standing dispute was resolved in 1993 by an official investigation of the discovery claims by the Transfermium Working Group, formed by the International Union of Pure and Applied Chemistry and the International Union of Pure and Applied Physics, resulting in credit for the discovery being officially shared between both teams. The element was formally named dubnium in 1997 after the town of Dubna, the site of the JINR. Theoretical research establishes dubnium as a member of group 5 in the 6d series of transition metals, placing it under vanadium, niobium, and tantalum. Dubnium should share most properties, such as its valence electron configuration and having a dominant +5 oxidation state, with the other group 5 elements, with a few anomalies due to relativistic effects. A limited investigation of dubnium chemistry has confirmed this.
Sources: en.wikipedia.org
== Other applications == Decontamination: Prolidase from the hyperthermophilic archaeon Pyrococcus furiosus (Pfprol) shows potential for application in decontamination of organophosphorus nerve agents in chemical warfare agents. Additionally, prolidase could also serve to detect fluorine-containing organophosphorus neurotoxins, like the G-type chemical warfare agents, and could antagonize organophosphorous intoxication and protect against the effects of diisopropylfluorophosphate when encapsulated in liposomes.
==== Established in the first team ==== Now back at Tottenham, Townsend started the second Premier League match of their 2013–14 season, and went on to make a total of 33 appearances, including 25 in the league. He scored twice, in a 5–0 away victory over Dinamo Tbilisi in the Europa League (his first match of the season), and his first in the Premier League in a 2–0 victory away to Aston Villa on 20 October 2013. In the middle of the season, Townsend came under the management of his third Tottenham boss, after Villas-Boas was replaced by Tim Sherwood. Sherwood's contract was terminated at the end of the season, and Townsend started the 2014–15 season under new manager Mauricio Pochettino. He made a total of 35 appearances, scoring five goals, but was reduced to just 17 appearances in the league, having been unable to hold down a starting place until the second half of the season. He started as Tottenham lost 2–0 to Chelsea in the 2015 League Cup Final at Wembley Stadium on 1 March. Having had nine loan spells, Townsend's career path to regular first team football for Tottenham is often discussed in the context of a wider debate in English football about the best way to develop young talent, contrasting the loan route with Premier League players being developed in Under-21 leagues, or being brought to the Premier League level via transfers from lower league clubs.
=== Examining what occurs at the cellular level of NL. === Tissue Architecture in NL Lesions A lesion is a tissue that has been altered or injured. They can occur as wounds or, in the case of progressive NL, ulcers. The tissue architecture of NL is characterized by degeneration of collagen in the dermis and subcutaneous layers. The lesions exhibit granulomatous inflammation, palisading granulomas, and thickened blood vessels. Palisading granulomas are significant because they show an immune cell ring around degenerated tissue, commonly seen in autoimmune and chronic inflammatory diseases. Thickened blood vessels occur due to an accumulation of immune cells. Together, all these structural features indicate NL as a chronic, inflammatory response. Fibroblasts and endothelial cells are malfunctioning, and there is an imbalance in tissue homeostasis. Fibroblast and collagen remodeling Fibroblasts contribute to the formation of connective tissue, collagen, and elastin. Failure in fibroblasts causes skin to atrophy and degenerate. Increased uptake of GLUT-1 (a glucose transporter) is observed in NL cases. When up-regulated: glycolysis, oxidative stress, and fibroblast proliferation all increase. Despite the metabolic increase, fibroblasts in NL dysfunction. This suggests that in NL tissue decay and dysfunction are linked to both structural and immunological tissue components. The tissue is observed to have increased GLUT-1 and decreased pro-collagen mRNA. A predominance of Type 1 collagen is observed in PL.
Sources: en.wikipedia.org
== Chemistry and animal toxicology == Buformin hydrochloride is a fine, white to slightly yellow, crystalline, odorless powder, with a weakly acidic bitter taste. Its melting point is 174 to 177 °C, it is a strong base, and is freely soluble in water, methanol and ethanol, but insoluble in chloroform and ether. The log octanol-water partition coefficient (log P) is -1.20E+00 and its water solubility is 7.46E+05 mg/L at 25 °C. Vapor pressure is 1.64E-04 mm Hg at 25 °C (EST); Henry's law constant is 8.14E-16 atm-m3/mole at 25 °C (EST). Its Atmospheric -OH rate constant is 1.60E-10 cm3/molecule-sec at 25 °C.
PLP plays a role in the conversion of levodopa into dopamine, facilitates the conversion of the excitatory neurotransmitter glutamate to the inhibitory neurotransmitter GABA, and allows SAM to be decarboxylated to form propylamine, which is a precursor to polyamines.
Cyanobacteria, the only prokaryotes performing oxygenic photosynthesis and the only prokaryotes that contain two types of photosystems (type I (RCI), also known as Fe-S type, and type II (RCII), also known as quinone type). The seven remaining prokaryotes have anoxygenic photosynthesis and use versions of either type I or type II. Chlorobi (green sulfur bacteria) Type I Heliobacteria Type I Chloracidobacterium Type I Proteobacteria (purple sulfur bacteria and purple non-sulfur bacteria) Type II (see: Purple bacteria) Chloroflexota (green non-sulfur bacteria) Type II Gemmatimonadota Type II Eremiobacterota Type II
== Use in drug delivery and release == Radioligands are administered through four main routes: intravenously, subcutaneous injection, intraperitoneally, and orally. While intravenous application is the most used route of injection, the route is dependent on the mechanism of action and overall aim of the binding. Before application of the ligand, clinicians will perform imaging, generally via positron emission tomography (PET) or single-photon emission computed tomography (SPECT) for baseline comparison after radioligand administration. Once the radioligand is administered, the radioligand will travel to the target tissue and selectively bind. The structure of the compound allows clinicians to easily identify the path traveled and the destination via repeated imaging and the signal put out by the radiotracer attached to the ligand. Direct radiotherapy performed via ionizing radiation can cause tissue damage and hypoxia to tissues other than the target. While this effect is lessened in a target radiotracer therapy utilizing radioligands, there is still an impact on the surrounding tissue described as Radiation Induced Bystander Effect (RIBE). Surrounding cells altered by the radioligand and displaying RIBE can show signs of stress, chromosomal abnormalities, or even experience cell death. However, the type of radiation used, whether 𝜶, β, or both can have a dramatically different effect on both the target binding site and surrounding tissue.
Sources: en.wikipedia.org
Dihexa is a synthetic peptide-like compound studied primarily in preclinical models. It is often classified as an angiotensin IV analog and has been investigated for effects on neuronal connectivity. It is not an approved drug or dietary supplement.
The exact mechanism is uncertain. Some research proposes activation of hepatocyte growth factor/c-Met signaling, while other evidence implicates insulin-regulated aminopeptidase. Multiple pathways may contribute, depending on the experimental system.
Published large-scale human trials are lacking. Most available data come from cell cultures and animal studies. As a result, human safety, appropriate dosing, and clinical effectiveness are not established.
Dihexa is a synthetic peptide modeled on angiotensin IV. It is used in laboratory and animal research, not as an approved medicine. Human effects remain poorly characterized.